Product Information
87980-1-PBS targets PAX3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16021 Product name: Recombinant human PAX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 341-426 aa of BC101301 Sequence: QSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVS Predict reactive species |
| Full Name | paired box 3 |
| Calculated Molecular Weight | 484 aa, 53 kDa |
| Observed Molecular Weight | 53-56 kDa |
| GenBank Accession Number | BC101301 |
| Gene Symbol | PAX3 |
| Gene ID (NCBI) | 5077 |
| RRID | AB_3745845 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23760 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PAX3, a transcription factor and multifunctional regulatory protein, is normally expressed during embryonic development. In the nervous system, PAX3 is involved in neural tube closure, neural crest development, and peripheral neuron differentiation. In the present study, PAX3 was reported as a novel regulator of GFAP transcription, and the overexpression and suppression of PAX3 could inhibit and promote NSC differentiation, respectively. In muscle development, PAX3 ensures the survival of myogenic progenitor cells with Pax3-expressing progenitors giving rise to both skeletal and smooth muscle cells. PAX3 also has a well-established role in the development of melanocytes during embryogenesis, and has recently been characterized as a molecular switch in the mature melanocyte. Mutations in PAX3 can cause Waardenburg syndrome.
