Published Applications
| IF | See 1 publications below |
Product Information
60236-1-Ig targets PAX7 in IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19171 Product name: Recombinant human PAX7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 463-518 aa of BC121165 Sequence: YGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT Predict reactive species |
| Full Name | paired box 7 |
| Calculated Molecular Weight | 520 aa, 57 kDa |
| GenBank Accession Number | BC121165 |
| Gene Symbol | PAX7 |
| Gene ID (NCBI) | 5081 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P23759 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAX7 belongs to the paired box protein family of transcription factors. It is an important regulator of neural and skeletal muscle development. Recent research indicates an essential function of Pax7 for renewal and maintenance of muscle stem cells. A chromosomal aberration involving PAX7 is a cause of rhabdomyosarcoma 2 (RMS2) which also known as alveolar rhabdomyosarcoma.
