PBX3 Polyclonal antibody, PBS Only

• 

  WB analysis of human lung using 12571-1-AP (same clone as 12571-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 12571-1-AP (PBX3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12571-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 12571-1-AP (same clone as 12571-1-PBS)

  IP result of anti-PBX3 (IP:12571-1-AP, 4ug; Detection:12571-1-AP 1:500) with HL-60 cells lysate 3040ug. This data was developed using the same antibody clone with 12571-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12571-1-AP (same clone as 12571-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12571-1-AP (PBX3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12571-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12571-1-AP (same clone as 12571-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PBX3 antibody (12571-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 12571-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PBX3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12571-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Homeobox protein PBX3, pre B cell leukemia homeobox 3, Pre-B-cell leukemia transcription factor 3

---

Product Information

12571-1-PBS targets PBX3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3239

  Product name: Recombinant human PBX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-367 aa of BC016977

  Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN

• Full Name: pre-B-cell leukemia homeobox 3
• Calculated Molecular Weight: 434 aa, 47 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC016977
• Gene Symbol: PBX3
• Gene ID (NCBI): 5090
• RRID: AB_2160469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40426
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.