PBX3 Polyclonal antibody

• 

  WB analysis of human lung using 12571-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12571-1-AP (PBX3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 12571-1-AP

  IP result of anti-PBX3 (IP:12571-1-AP, 4ug; Detection:12571-1-AP 1:500) with HL-60 cells lysate 3040ug.

• 

  IHC staining of human lung cancer using 12571-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12571-1-AP (PBX3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 12571-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PBX3 antibody (12571-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

PBX3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12571-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, chIP, RIP, ELISA

Synonyms

Homeobox protein PBX3, pre B cell leukemia homeobox 3, Pre-B-cell leukemia transcription factor 3

---

Tested Applications

• Positive WB detected in: human lung tissue
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 9 publications below
• IHC: See 3 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• ChIP: See 4 publications below
• RIP: See 1 publications below

Product Information

12571-1-AP targets PBX3 in WB, IHC, IF/ICC, IP, chIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3239

  Product name: Recombinant human PBX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-367 aa of BC016977

  Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN

• Full Name: pre-B-cell leukemia homeobox 3
• Calculated Molecular Weight: 434 aa, 47 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC016977
• Gene Symbol: PBX3
• Gene ID (NCBI): 5090
• RRID: AB_2160469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40426
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; Circular RNA circCORO1C promotes laryngeal squamous cell carcinoma progression by modulating the let-7c-5p/PBX3 axis.; Authors - Yongyan Wu
human	WB	Haematologica; P2X7 promotes the progression of MLL-AF9 induced acute myeloid leukemia by upregulation of Pbx3.; Authors - Wenli Feng ; KD Validated
mouse,human	IF	Cell Mol Gastroenterol Hepatol; scRNA-Seq Reveals New Enteric Nervous System Roles for GDNF, NRTN, and TBX3.; Authors - Christina M Wright
rat	IF	Free Radic Biol Med; Systematical exploration of transcription factors in cardiomyocytes against hydrogen peroxide-induced oxidative stress by Danhong injection.; Authors - Jingjing Zhang
mouse,human	WB,IHC	Int J Biol Sci; USF1-ATRAP-PBX3 Axis Promote Breast Cancer Glycolysis and Malignant Phenotype by Activating AKT/mTOR Signaling.; Authors - Dandan Wang
rat,human	IF	Sci Rep; Screening and identification of critical transcription factors involved in the protection of cardiomyocytes against hydrogen peroxide-induced damage by Yixin-shu.; Authors - Jingjing Zhang