Tested Applications
| Positive WB detected in | human lung tissue |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12571-1-AP targets PBX3 in WB, IHC, IF/ICC, IP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3239 Product name: Recombinant human PBX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-367 aa of BC016977 Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN Predict reactive species |
| Full Name | pre-B-cell leukemia homeobox 3 |
| Calculated Molecular Weight | 434 aa, 47 kDa |
| Observed Molecular Weight | 47-50 kDa |
| GenBank Accession Number | BC016977 |
| Gene Symbol | PBX3 |
| Gene ID (NCBI) | 5090 |
| RRID | AB_2160469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40426 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PBX3 antibody 12571-1-AP | Download protocol |
| IHC protocol for PBX3 antibody 12571-1-AP | Download protocol |
| IP protocol for PBX3 antibody 12571-1-AP | Download protocol |
| WB protocol for PBX3 antibody 12571-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PBX3 antibody (catalog number 12571-1-AP) has 23 citations. These appear in journals including Molecular Cancer, Haematologica, International Journal of Biological Sciences, Journal of Translational Medicine, Free Radical Biology and Medicine, iScience, BMC Cancer, PLoS Genetics, Experimental Cell Research, and Biochemical and Biophysical Research Communications. Research fields span oncology (gastric, breast, colorectal, thyroid, pancreatic, and leukemia cancers), cardiovascular disease, developmental biology, and epigenetics, with applications in WB, IHC, IF, ChIP, and IP.
| Species | Application | Title |
|---|---|---|
Mol Cancer Circular RNA circCORO1C promotes laryngeal squamous cell carcinoma progression by modulating the let-7c-5p/PBX3 axis. | ||
Biomark Res Single-cell and spatial transcriptome analysis reveals the potential therapeutic targets for testicular sex cord-stromal cell tumor. | ||
Int J Biol Sci USF1-ATRAP-PBX3 Axis Promote Breast Cancer Glycolysis and Malignant Phenotype by Activating AKT/mTOR Signaling. | ||
J Transl Med Folate promotes colorectal cancer progression by impairing CD8(+) T cell function and recruitment via SLC19A1/p-AKT/NOTCH1 axis and CCL5 downregulation. | ||
Int J Surg Supervising the recurrence of pancreatic ductal adenocarcinoma using CtDNA-based MIR129-2 methylation detection | ||
Haematologica P2X7 promotes the progression of MLL-AF9 induced acute myeloid leukemia by upregulation of Pbx3.
|
