Tested Applications
| Positive WB detected in | mouse pancreas tissue |
| Positive IHC detected in | mouse liver tissue, human liver cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15702-1-AP targets PCBD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8331 Product name: Recombinant human PCBD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC006324 Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Predict reactive species |
| Full Name | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha |
| Calculated Molecular Weight | 104 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC006324 |
| Gene Symbol | PCBD1 |
| Gene ID (NCBI) | 5092 |
| RRID | AB_2267945 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61457 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCBD1, also known as DCOH and PCBD, belongs to the pterin-4-alpha-carbinolamine dehydratase family. PCBD1 is a bifunctional protein that acts as an enzyme in the regeneration of cofactor tetrahydrobiopterin (BH4), crucial for the function of aromatic amino acid hydroxylases, and as a dimerization cofactor of transcription factors HNF1A and HNF1B, important in liver and pancreas development and function. PCBD1 is expressed in the developing pancreas. The calculated molecular weight of PCBD1 is 12 kDa (PMID: 24204001, 24848070).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PCBD1 antibody 15702-1-AP | Download protocol |
| IHC protocol for PCBD1 antibody 15702-1-AP | Download protocol |
| WB protocol for PCBD1 antibody 15702-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













