PCDH17 Polyclonal antibody, PBS Only

• 

  WB analysis using 17915-1-AP (same clone as 17915-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17915-1-AP (PCDH17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17915-1-PBS in a different storage buffer formulation.

PCDH17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17915-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17915-1-PBS targets PCDH17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12322

  Product name: Recombinant human PCDH17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 812-1159 aa of BC028165

  Sequence: EVMYLKPASNNLTVPQGHAGCHTSFTGQGTNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADSDQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPAANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLKAKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDGCEAKPGALAEASSQYLPTDSQYLSPSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK

• Full Name: protocadherin 17
• Calculated Molecular Weight: 1159 aa, 126 kDa
• Observed Molecular Weight: 160-170 kDa
• GenBank Accession Number: BC028165
• Gene Symbol: PCDH17
• Gene ID (NCBI): 27253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14917
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.