PCDH18 Polyclonal antibody

• 

  IHC staining of mouse brain using 18026-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18026-1-AP (PCDH18 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18026-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18026-1-AP (PCDH18 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PCDH18 Polyclonal Antibody for ELISA

Cat No. 18026-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

KIAA1562, PCDH18, PCDH68L, protocadherin 18

---

Product Information

18026-1-AP targets PCDH18 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12591

  Product name: Recombinant human PCDH18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 792-1135 aa of BC093815

  Sequence: SRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEQVSQLLSMLHQGQYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEGFSDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQQQHPHQSLEDDAQPADSGEKKKSFSTFGKDSPNDEDTGDTSTSSLLSEMSSVFQRLLPPSLDTYSECSEVDRSNSLERRKGPLPAKTVGYPQGVAAWAASTHFQNPTTNCGPPLGTHSSVQPSSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS

• Full Name: protocadherin 18
• Calculated Molecular Weight: 1135 aa, 126 kDa
• GenBank Accession Number: BC093815
• Gene Symbol: PCDH18
• Gene ID (NCBI): 54510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.