Tested Applications
| Positive WB detected in | K-562 cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IF | See 1 publications below |
Product Information
23540-1-AP targets PCF11 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20263 Product name: Recombinant human PCF11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1206-1555 aa of BC146778 Sequence: IPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV Predict reactive species |
| Full Name | PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) |
| Calculated Molecular Weight | 1555 aa, 173 kDa |
| Observed Molecular Weight | 173 kDa |
| GenBank Accession Number | BC146778 |
| Gene Symbol | PCF11 |
| Gene ID (NCBI) | 51585 |
| RRID | AB_2879293 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O94913 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In Saccharomyces cerevisiae, the cleavage/polyadenylation factor Pcf11 is a crucial regulatory factor required for recruiting polyadenylation machinery to elongating RNA polymerase II (RNAPII), and is necessary for correct transcriptional termination. Pcf11 (PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)), is a 1,555 amino acid nuclear protein that is a component of pre-mRNA cleavage complex II. It is suggested that Pcf11 is capable of promoting the dissociation of Pol II elongation complexes from DNA. Pcf11 contains a CTD-interaction domain that binds in a phospho-dependent manner to the heptad repeats within the RNA polymerase II CTD. The gene encoding Pcf11 is located on human chromosoem 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11. This antibody is specific to the 173kd human PCF11 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PCF11 antibody 23540-1-AP | Download protocol |
| IP protocol for PCF11 antibody 23540-1-AP | Download protocol |
| WB protocol for PCF11 antibody 23540-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell RNA Pol II preferentially regulates ribosomal protein expression by trapping disassociated subunits | ||
Neuron Suppression of premature transcription termination leads to reduced mRNA isoform diversity and neurodegeneration. | ||
Nucleic Acids Res CRISPRpas: programmable regulation of alternative polyadenylation by dCas9.
| ||
Cell Rep LINC00921 reduces lung cancer radiosensitivity by destabilizing NUDT21 and driving aberrant MED23 alternative polyadenylation | ||
Biochimie An investigation into the role of ATP in the mammalian pre-mRNA 3' cleavage reaction. | ||
Sci China Life Sci Mutual regulation between cell cycle and transcription termination factor TTF2 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Fabienne (Verified Customer) (05-09-2025) | I obtained two major bands in western blot, one between 170 and 235 KDa and another above 235 KDa. Tested on nuclear cell extracts
![]() |








