PCMTD1 Polyclonal antibody

• 

  WB analysis using 24425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24425-1-AP (PCMTD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24425-1-AP (PCMTD1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24425-1-AP (PCMTD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 24425-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PCMTD1 antibody (24425-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PCMTD1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24425-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Protein-L-isoaspartate O-methyltransferase domain-containing protein 1, Protein L isoaspartate O methyltransferase domain containing protein 1

---

Tested Applications

• Positive WB detected in: rat liver tissue, human placenta tissue, hTERT-RPE1 cells, mouse eye tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24425-1-AP targets PCMTD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19634

  Product name: Recombinant human PCMTD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-357 aa of BC032670

  Sequence: IYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPLDSEEDEKMEEDIKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK

• Full Name: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1
• Calculated Molecular Weight: 357 aa, 41 kDa
• Observed Molecular Weight: 41 kDa, 27 kDa
• GenBank Accession Number: BC032670
• Gene Symbol: PCMTD1
• Gene ID (NCBI): 115294
• RRID: AB_3669436
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MG8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein-l-isoaspartate O-methyltransferase domain-containing protein 1 (PCMTD1) is a putative E3 ubiquitin ligase substrate adaptor protein, which has a C-terminal domain containing SOCS-box ubiquitin ligase recruitment motifs. PCMTD1 protein may provide an alternate maintenance pathway for modified proteins in mammalian cells (PMID: 35486881). This antibody can detect two isoforms of PCMTD1, 27 kDa and 41 kDa respectively (PMID: 37953789, 35486881).