PCNP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCNP Polyclonal antibody (29305-1-AP)

• 

  WB analysis using 29305-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29305-1-AP (PCNP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 29305-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 29305-1-AP (PCNP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PCNP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29305-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein

---

Tested Applications

• Positive WB detected in: A2780 cells, Jurkat cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29305-1-AP targets PCNP in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30951

  Product name: Recombinant human PCNP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC013916

  Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI

• Full Name: PEST proteolytic signal containing nuclear protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013916
• Gene Symbol: PCNP
• Gene ID (NCBI): 57092
• RRID: AB_2918277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PEST-containing nuclear protein (PCNP), characterized by a PEST motif rich in proline (P), glutamic acid (E), serine (S), and threonine (T), is firstly identified by database mining. The PCNP protein with the PEST motif is highly subjected to ubiquitination. PCNP may act as a transcriptional factor, cell cycle regulatory protein and tumor regulating nuclear protein.(PMID: 35813472, PMID: 32548978, PMID: 31487123)