Tested Applications
Positive WB detected in | A2780 cells, Jurkat cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
29305-1-AP targets PCNP in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30951 Product name: Recombinant human PCNP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI Predict reactive species |
Full Name | PEST proteolytic signal containing nuclear protein |
Calculated Molecular Weight | 19 kDa |
Observed Molecular Weight | 24-28 kDa |
GenBank Accession Number | BC013916 |
Gene Symbol | PCNP |
Gene ID (NCBI) | 57092 |
RRID | AB_2918277 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WW12 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PCNP antibody 29305-1-AP | Download protocol |
IHC protocol for PCNP antibody 29305-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |