PCNP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86075-1-RR (same clone as 86075-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86075-1-RR (PCNP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86075-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86075-1-RR (same clone as 86075-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PCNP antibody (86075-1-RR, Clone: 250576B6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86075-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86075-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86075-1-RR against Human PCNP were performed. The affinity constant is 1.41 nM.

PCNP Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86075-1-PBS

Clone No.250576B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein

---

Product Information

86075-1-PBS targets PCNP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30951

  Product name: Recombinant human PCNP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC013916

  Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI

• Full Name: PEST proteolytic signal containing nuclear protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013916
• Gene Symbol: PCNP
• Gene ID (NCBI): 57092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WW12
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.