Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20417-1-AP targets PCNXL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14161 Product name: Recombinant human PCNXL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1108-1201 aa of BC008300 Sequence: LSFAVSASTVFLSLRPFLSIVLFALAGAVGFVTHYVLPQLRKHHPWMWISHPILKNKEYHQREVRDVAHLMWFERLYVWLQCFEKYILYPALIL Predict reactive species |
Full Name | pecanex-like 2 (Drosophila) |
Calculated Molecular Weight | 2137 aa, 237 kDa |
Observed Molecular Weight | 237-260 kDa |
GenBank Accession Number | BC008300 |
Gene Symbol | PCNXL2 |
Gene ID (NCBI) | 80003 |
RRID | AB_10792807 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A6NKB5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCNXL2, also named as KIAA0435, belongs to the pecanex family. It may play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors. PCNXL2 is a glycosylation protein. The MW migrates to 260kd.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PCNXL2 antibody 20417-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |