PCNXL2 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 20417-1-AP (same clone as 20417-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20417-1-AP (PCNXL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20417-1-AP (same clone as 20417-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20417-1-AP (PCNXL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20417-1-PBS in a different storage buffer formulation.

PCNXL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20417-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20417-1-PBS targets PCNXL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14161

  Product name: Recombinant human PCNXL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1108-1201 aa of BC008300

  Sequence: LSFAVSASTVFLSLRPFLSIVLFALAGAVGFVTHYVLPQLRKHHPWMWISHPILKNKEYHQREVRDVAHLMWFERLYVWLQCFEKYILYPALIL

• Full Name: pecanex-like 2 (Drosophila)
• Calculated Molecular Weight: 2137 aa, 237 kDa
• Observed Molecular Weight: 237-260 kDa
• GenBank Accession Number: BC008300
• Gene Symbol: PCNXL2
• Gene ID (NCBI): 80003
• RRID: AB_10792807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NKB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCNXL2, also named as KIAA0435, belongs to the pecanex family. It may play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors. PCNXL2 is a glycosylation protein. The MW migrates to 260kd.