Tested Applications
Positive WB detected in | HeLa cells, L02 cells, mouse testis tissue, rat testis tissue |
Positive IF/ICC detected in | U-251 cells, A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
30991-1-AP targets PCYT1A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species |
Full Name | phosphate cytidylyltransferase 1, choline, alpha |
Calculated Molecular Weight | 42 kDa |
Observed Molecular Weight | 40-41 kDa |
GenBank Accession Number | NM_005017 |
Gene Symbol | PCYT1A |
Gene ID (NCBI) | 5130 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity Purification |
UNIPROT ID | P49585 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCYT1A (phosphate cytidylyltransferase 1A, choline), also known as CTPCT. It is expected to be located in the nucleus and cytoplasm, which is enriched in brain, placenta, liver, fetal and adult lung. This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. The molecular weight of PCYT1A is 41 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PCYT1A antibody 30991-1-AP | Download protocol |
IF protocol for PCYT1A antibody 30991-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |