Product Information
83100-3-PBS targets PCYT1A as part of a matched antibody pair:
MP00303-1: 83100-3-PBS capture and 83100-4-PBS detection (validated in Cytometric bead array)
MP00303-3: 83100-3-PBS capture and 83100-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species |
| Full Name | phosphate cytidylyltransferase 1, choline, alpha |
| Calculated Molecular Weight | 42 kDa |
| GenBank Accession Number | NM_005017 |
| Gene Symbol | PCYT1A |
| Gene ID (NCBI) | 5130 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49585 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



