PDCD2L Monoclonal antibody, PBS Only

• 

  WB analysis using 68249-1-Ig (same clone as 68249-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68249-1-Ig (PDCD2L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68249-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68249-1-Ig (same clone as 68249-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68249-1-Ig (PDCD2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68249-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 68249-1-Ig (same clone as 68249-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using PDCD2L antibody (68249-1-Ig, Clone: 2G12C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68249-1-PBS in a different storage buffer formulation.

PDCD2L Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68249-1-PBS

Clone No.2G12C4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PDCD2L, programmed cell death 2 like

---

Product Information

68249-1-PBS targets PDCD2L in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30807

  Product name: Recombinant human PDCD2L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 80-179 aa of BC006146

  Sequence: CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP

• Full Name: programmed cell death 2-like
• Calculated Molecular Weight: 358 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC006146
• Gene Symbol: PDCD2L
• Gene ID (NCBI): 84306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDCD2L was aberrantly expressed in multiple types of human cancers, and associated with clinical stage and molecular subtype and PDCD2L could be served as a biomarker of CRC (PMID: 35216602).