PDCD2L Monoclonal antibody

• 

  WB analysis using 68249-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 68249-1-Ig (PDCD2L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 68249-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68249-1-Ig (PDCD2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 68249-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using PDCD2L antibody (68249-1-Ig, Clone: 2G12C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

PDCD2L Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68249-1-Ig

Clone No.2G12C4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

PDCD2L, programmed cell death 2 like

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, HCT 116 cells, HeLa cells, K-562 cells, HepG2 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68249-1-Ig targets PDCD2L in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30807

  Product name: Recombinant human PDCD2L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 80-179 aa of BC006146

  Sequence: CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP

• Full Name: programmed cell death 2-like
• Calculated Molecular Weight: 358 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC006146
• Gene Symbol: PDCD2L
• Gene ID (NCBI): 84306
• RRID: AB_3085049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDCD2L was aberrantly expressed in multiple types of human cancers, and associated with clinical stage and molecular subtype and PDCD2L could be served as a biomarker of CRC (PMID: 35216602).