PDCD4 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK293 cells using 66100-1-Ig (same clone as 66100-1-PBS)

  WB result of PDCD4 antibody (66100-1-Ig, 1:4000) with si-control and si-PDCD4 transfected HEK293 cells. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66100-1-Ig (same clone as 66100-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66100-1-Ig (PDCD4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66100-1-Ig (same clone as 66100-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66100-1-Ig (PDCD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66100-1-Ig (same clone as 66100-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66100-1-Ig (PDCD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66100-1-Ig (same clone as 66100-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66100-1-Ig (PDCD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66100-1-Ig (same clone as 66100-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66100-1-Ig (PDCD4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66100-1-Ig (same clone as 66100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66100-1-Ig (PDCD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66100-1-Ig (same clone as 66100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66100-1-Ig (PDCD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66100-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PDCD4 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66100-1-PBS

Clone No.1F1A11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

H731, Nuclear antigen H731 like, PDCD4, Protein 197/15a

---

Product Information

66100-1-PBS targets PDCD4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19239

  Product name: Recombinant human PDCD4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 169-469 aa of BC026104

  Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

• Full Name: programmed cell death 4 (neoplastic transformation inhibitor)
• Calculated Molecular Weight: 469 aa, 52 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC026104
• Gene Symbol: PDCD4
• Gene ID (NCBI): 27250
• RRID: AB_2881499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q53EL6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Programmed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A.