PDE4C Polyclonal antibody

• 

  WB analysis of HEK-293 using 21754-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21754-1-AP (PDE4C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 21754-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21754-1-AP (PDE4C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

PDE4C Polyclonal Antibody for WB, ELISA

Cat No. 21754-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

DPDE1, PDE21, PDE4C

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below

Product Information

21754-1-AP targets PDE4C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16130

  Product name: Recombinant human PDE4C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-91 aa of BC109067

  Sequence: EYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK

• Full Name: phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
• Calculated Molecular Weight: 712 aa, 80 kDa
• Observed Molecular Weight: ~70 kDa
• GenBank Accession Number: BC109067
• Gene Symbol: PDE4C
• Gene ID (NCBI): 5143
• RRID: AB_10860265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08493
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE4C(cAMP-specific 3,5-cyclic phosphodiesterase 4C) is also named as DPDE1 and belongs to the PDE4 subfamily, which play a key role in lung inflammation and hyperresponsiveness. PDE4C promotes the hydrolysis of cAMP, and PKD2, functioning as a Ca2+ entry channel, may mediate local accumulation of Ca2+ that inhibits the activity of Ca2+-sensitive ADCY5(PMID:21670265). The three isoforms(84,75, and 64 kDa) of PDE4C have been detected in cytosolic, microsomal, and nuclear (PMID:21784969).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	JCI Insight; Inhibition of phosphodiesterase 4D suppresses mTORC1 signaling and pancreatic cancer growth; Authors - Mi-Hyeon Jeong
mouse	WB	Mol Metab; Inhibition of prolyl hydroxylases increases hepatic insulin and decreases glucagon sensitivity by an HIF-2α-dependent mechanism.; Authors - Matthew Riopel
mouse	WB	Biochem Pharmacol; DC591017, a phosphodiesterase-4 (PDE4) inhibitor with robust anti-inflammation through regulating PKA-CREB signaling.; Authors - Heng Li
mouse	WB	Am J Physiol Renal Physiol; Inhibition of PDE4/PDE4B improves renal function and ameliorates inflammation in cisplatin-induced acute kidney injury.; Authors - Man Xu
human	WB	Atherosclerosis; A novel protein encoded by circLARP1B promotes the proliferation and migration of vascular smooth muscle cells by suppressing cAMP signaling; Authors - Peng Lu
	WB	J Cell Mol Med; Analysis of the effects of M2 macrophage-derived PDE4C on the prognosis, metastasis and immunotherapy benefit of osteosarcoma; Authors - Feng Pan