Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26277-1-AP targets PDE7A in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24334 Product name: Recombinant human PDE7A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC126360 Sequence: MGITLIWCLALVLIKWITSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESER Predict reactive species |
| Full Name | phosphodiesterase 7A |
| Calculated Molecular Weight | 482 aa, 56 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC126360 |
| Gene Symbol | PDE7A |
| Gene ID (NCBI) | 5150 |
| RRID | AB_2880458 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13946 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PDE7A antibody 26277-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



