PDE8B Polyclonal antibody

• 

  WB analysis using 30708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30708-1-AP (PDE8B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 30708-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30708-1-AP (PDE8B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 30708-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30708-1-AP (PDE8B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 30708-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PDE8B antibody (30708-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

PDE8B Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 30708-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

HsPDE8B, phosphodiesterase 8B, PPNAD3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human placenta tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

30708-1-AP targets PDE8B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33477

  Product name: Recombinant human PDE8B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-440 aa of NM_003719

  Sequence: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS

• Full Name: phosphodiesterase 8B
• Calculated Molecular Weight: 99kd
• Observed Molecular Weight: 68-98 kDa
• GenBank Accession Number: NM_003719
• Gene Symbol: PDE8B
• Gene ID (NCBI): 8622
• RRID: AB_3086395
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95263
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human phosphodiesterase (PDE) type 8B (PDE8B) is located at 5q14.1 and is known as the PDE with the highest affinity to cAMP.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cardiovasc Med; Machine learning-driven exploration of therapeutic targets for atrial fibrillation-joint analysis of single-cell and bulk transcriptomes and experimental validation.; Authors - Yicheng Wang
sheep	WB	Animals (Basel); DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep.; Authors - Lina Zhu