Tested Applications
| Positive WB detected in | mouse brain tissue, rat kidney tissue, mouse kidney tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26940-1-AP targets PDGFA in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25643 Product name: Recombinant human PDGFA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 135-196 aa of BC146594 Sequence: TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR Predict reactive species |
| Full Name | platelet-derived growth factor alpha polypeptide |
| Calculated Molecular Weight | 196 aa, 22 kDa |
| Observed Molecular Weight | 13-16 kDa |
| GenBank Accession Number | BC146594 |
| Gene Symbol | PDGFA |
| Gene ID (NCBI) | 5154 |
| RRID | AB_3669576 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04085 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDGFA is a member of the platelet-derived growth factor family. Four members of this family are mitogenic factors for cells of mesenchymal origin, and they are characterized by a motif of eight cysteines. PDGFA plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, and chemotaxis. It is also required for normal lung alveolar septum formation during embryogenesis, development of the gastrointestinal tract, and spermatogenesis. PDGFA is also involved in oligodendrocyte development and the myelination process in the spinal cord and cerebellum. PDGF-A protein monomer is about 13-16 kDa, and PDGF-AA is a 28.5 kDa A chain homodimer.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PDGFA antibody 26940-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







