PDGF-BB Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PDGF-BB Recombinant monoclonal antibody (83214-5-RR)

• 

  WB analysis using 83214-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83214-5-RR (PDGFB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 83214-5-RR

  A549 cells were subjected to SDS PAGE followed by western blot with 83214-5-RR (PDGFB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83214-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83214-5-RR against Human PDGFB were performed. The affinity constant is 16.9 nM.

PDGF-BB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83214-5-RR

Clone No.230486A7

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PDGFB, PDGFbb, PDGF2, PDGF subunit B, PDGF 2

---

Tested Applications

• Positive WB detected in: HUVEC cells, A549 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

83214-5-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25986

  Product name: Recombinant human PDGFB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC029822

  Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA

• Full Name: platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
• Calculated Molecular Weight: 241 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC029822
• Gene Symbol: PDGFB
• Gene ID (NCBI): 5155
• RRID: AB_3670899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01127-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet-derived growth factor (PDGF) belongs to the family of growth factors consisting of four secreted extracellular ligands including PDGF-A, -B, -C and -D. These isoforms, PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD, act via two receptor tyrosine kinases, PDGF receptors alpha and beta. PDGF isoforms stimulate growth, survival and motility of mesenchymal cells and certain other cell type. They have important functions during embryonal development and in the control of tissue homeostasis in the adult. PDGF-BB is one of the most recently studied isoforms and it plays an important role in skeletal development. PDGF-BB stimulates cell-mediated collagen gel contraction. PDGF-BB modulates endothelial proliferation and angiogenesis in vitro via PDGF beta-receptors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mater Today Bio; Hepatic cavernous hemangioma decellularized extracellular matrix/GelMA composite hydrogel promotes angiogenesis via the ITGA9-FAK-ERK1/2 axis.; Authors - Zongbo Dai
		JACC Basic Transl Sci; Hypoxanthine Promotes Pulmonary Vascular Remodeling and Adenosine Deaminase Is a Therapeutic Target for Pulmonary Hypertension; Authors - Jun-Zhuo Shi