Tested Applications
| Positive WB detected in | HUVEC cells, A549 cells, mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83214-5-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25986 Product name: Recombinant human PDGFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC029822 Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA Predict reactive species |
| Full Name | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Calculated Molecular Weight | 241 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC029822 |
| Gene Symbol | PDGFB |
| Gene ID (NCBI) | 5155 |
| RRID | AB_3670899 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P01127-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet-derived growth factor (PDGF) belongs to the family of growth factors consisting of four secreted extracellular ligands including PDGF-A, -B, -C and -D. These isoforms, PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD, act via two receptor tyrosine kinases, PDGF receptors alpha and beta. PDGF isoforms stimulate growth, survival and motility of mesenchymal cells and certain other cell type. They have important functions during embryonal development and in the control of tissue homeostasis in the adult. PDGF-BB is one of the most recently studied isoforms and it plays an important role in skeletal development. PDGF-BB stimulates cell-mediated collagen gel contraction. PDGF-BB modulates endothelial proliferation and angiogenesis in vitro via PDGF beta-receptors.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PDGF-BB antibody 83214-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





