• Featured Product
  • KD/KO Validated

PDRG1 Recombinant monoclonal antibody

PDRG1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85851-4-RR
Clone No.250203E9

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

C20orf126, p53 and DNA damage regulated 1, p53 and DNA damage-regulated protein 1, PDRG

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, HeLa cells, A549 cells, MCF-7 cells, rat liver tissue
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85851-4-RR targets PDRG1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9109

Product name: Recombinant human PDRG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-133 aa of BC009334

Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

Predict reactive species
Full Name p53 and DNA damage regulated 1
Calculated Molecular Weight 16 kDa
Observed Molecular Weight15-16 kDa
GenBank Accession NumberBC009334
Gene Symbol PDRG1
Gene ID (NCBI) 81572
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NUG6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDRG1 codes for a novel protein called p53 and DNA damage-regulated protein 1. Human PDRG1 is predominantly expressed in normal testis and its expression can be induced by UV irradiation and be repressed by p53 [PMID14562055]. Recently, PDRG1 was identified as a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress. Its expression was upregulated in multiple malignancies including cancers of the colon, rectum, ovary, lung, stomach, breast and uterus when compared to normal tissues [PMID: 21193842], suggesting its being a novel tumor marker that could play a role in cancer development and/or progression.

Protocols

Product Specific Protocols
WB protocol for PDRG1 antibody 85851-4-RRDownload protocol
IHC protocol for PDRG1 antibody 85851-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...