PDS5B Polyclonal antibody

PDS5B Polyclonal Antibody for WB, ELISA
Cat No. 28318-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3, APRIN, AS3, CG008

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, SKOV-3 cells, mouse testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28318-1-AP targets PDS5B in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27977

Product name: Recombinant human PDS5B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1139-1310 aa of NM_015032

Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT

Predict reactive species
Full Name PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Calculated Molecular Weight 165 aa
Observed Molecular Weight150 kDa
GenBank Accession NumberNM_015032
Gene Symbol PDS5B
Gene ID (NCBI) 23047
RRIDAB_2881111
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NTI5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDS5B (PDS5 Cohesin Scc1-like Protein B) is a protein associated with sister chromatid cohesion and maintenance of chromosome structure. It plays a significant role in cell cycle regulation, DNA repair, and gene expression. PDS5B interacts with the cohesin complex to ensure the proper separation of sister chromatids during cell division. Additionally, PDS5B is crucial in DNA damage repair, particularly during homologous recombination, helping to maintain genomic stability. It also indirectly affects gene expression and chromatin structure by modulating the function of the cohesin complex. PDS5B is widely expressed during embryonic development and is highly expressed in the brain and testes in adulthood. Its dysfunction is associated with multiple diseases, including Cohesinopathies and Cornelia de Lange syndrome.

Protocols

Product Specific Protocols
WB protocol for PDS5B antibody 28318-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...