PDS5B Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02392-1

  The mean PDS5B concentration was determined to be 61.70 ng/mL in SKOV-3 cell extract based on a 1.20 mg/mL extract load and 55.20 ng/mL in HeLa cell extract based on a 0.90 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02392-1

  Sandwich ELISA standard curve of MP02392-1, Human PDS5B Recombinant Matched Antibody Pair - PBS only. 86088-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag27977. 86088-3-PBS was HRP conjugated as the detection antibody. Range: 0.78-50 ng/mL.

PDS5B Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86088-3-PBS

Clone No.250461B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3, APRIN, AS3, CG008

---

Product Information

86088-3-PBS targets PDS5B as part of a matched antibody pair:

MP02392-1: 86088-1-PBS capture and 86088-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27977

  Product name: Recombinant human PDS5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1139-1310 aa of NM_015032

  Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT

• Full Name: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
• Calculated Molecular Weight: 165 aa
• GenBank Accession Number: NM_015032
• Gene Symbol: PDS5B
• Gene ID (NCBI): 23047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NTI5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.