Tested Applications
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
12518-1-AP targets MAP17 / PDZK1IP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3206 Product name: Recombinant human PDZK1IP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-114 aa of BC012303 Sequence: VPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVKHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM Predict reactive species |
| Full Name | PDZK1 interacting protein 1 |
| Calculated Molecular Weight | 114 aa, 12 kDa |
| GenBank Accession Number | BC012303 |
| Gene Symbol | MAP17 |
| Gene ID (NCBI) | 10158 |
| RRID | AB_3085395 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13113 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDZK1-interacting protein 1(PDZK1IP1), also known as MAP17, is a membrane-associated protein. MAP17 / PDZK1IP1 is overexpressed in a variety of human carcinomas, and overexpression of MAP17 / PDZK1IP1 protein is strongly correlated with the progression of prostate and ovarian carcinomas (PMID: 17426052). MAP17 / PDZK1IP1 has been proven to be an oncogene for tumorigenesis and development of papillary thyroid cancer (PTC) (PMID: 36057192; PMID: 35727731).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP | Download protocol |
| IHC protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





