PEA15 Polyclonal antibody

• 

  WB analysis of fetal human brain using 21446-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21446-1-AP (PEA15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21446-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21446-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21446-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PEA15 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21446-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HMAT1, HUMMAT1H, MAT1, MAT1H, PEA 15, PEA15, PED

---

Tested Applications

• Positive WB detected in: fetal human brain tissue
• Positive IHC detected in: mouse brain tissue, human heart tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

21446-1-AP targets PEA15 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13782

  Product name: Recombinant human PEA15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-130 aa of BC002426

  Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

• Full Name: phosphoprotein enriched in astrocytes 15
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC002426
• Gene Symbol: PEA15
• Gene ID (NCBI): 8682
• RRID: AB_2878858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15121
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Cancer; The microRNA212 regulated PEA15 promotes ovarian cancer progression by inhibiting of apoptosis.; Authors - Yonghong Luo ; KD Validated