Tested Applications
| Positive WB detected in | fetal human brain tissue |
| Positive IHC detected in | mouse brain tissue, human heart tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21446-1-AP targets PEA15 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species |
| Full Name | phosphoprotein enriched in astrocytes 15 |
| Calculated Molecular Weight | 130 aa, 15 kDa |
| Observed Molecular Weight | 15-18 kDa |
| GenBank Accession Number | BC002426 |
| Gene Symbol | PEA15 |
| Gene ID (NCBI) | 8682 |
| RRID | AB_2878858 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15121 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PEA15 antibody 21446-1-AP | Download protocol |
| WB protocol for PEA15 antibody 21446-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PEA15 Polyclonal antibody (Cat# 21446-1-AP) has 3 citations. They appear in Journal of Inflammation Research, Journal of Cancer, and International Journal of Biological Markers. The associated research fields include sepsis and energy metabolism, ovarian cancer progression via apoptosis inhibition, and endometrial carcinoma prognosis. All studies used human samples with WB and/or IHC applications.
| Species | Application | Title |
|---|---|---|
J Inflamm Res Evaluating the Diagnostic Value and Molecular Mechanism of Energy Metabolism-Related Gene PEA15 in Sepsis. | ||
J Cancer The microRNA212 regulated PEA15 promotes ovarian cancer progression by inhibiting of apoptosis.
| ||
Int J Biol Markers The autophagy-related gene PEA15 is a potential prognostic biomarker for early-stage endometrial carcinoma. |
Reviews
What customers say
The single review for this antibody is a 5-star rating from a Western Blot application using cancer cells at a 1:1000 dilution. The reviewer reported that the antibody worked well with no non-specific binding and recommended it for use. Overall, the feedback is positive, highlighting clean specificity and reliable performance in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sonam (Verified Customer) (02-23-2026) | Worked well. I recommend this Ab. No Non specific binding.
|
