Tested Applications
Positive WB detected in | fetal human brain tissue |
Positive IHC detected in | mouse brain tissue, human heart tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
21446-1-AP targets PEA15 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species |
Full Name | phosphoprotein enriched in astrocytes 15 |
Calculated Molecular Weight | 130 aa, 15 kDa |
Observed Molecular Weight | 15-18 kDa |
GenBank Accession Number | BC002426 |
Gene Symbol | PEA15 |
Gene ID (NCBI) | 8682 |
RRID | AB_2878858 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15121 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PEA15 antibody 21446-1-AP | Download protocol |
IHC protocol for PEA15 antibody 21446-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |