Tested Applications
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83958-3 targets PEA15 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species |
| Full Name | phosphoprotein enriched in astrocytes 15 |
| Calculated Molecular Weight | 130 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC002426 |
| Gene Symbol | PEA15 |
| Gene ID (NCBI) | 8682 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15121 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Phosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PEA15 antibody CL488-83958-3 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

