PELI1 Polyclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 12053-1-AP (same clone as 12053-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 12053-1-AP (PELI1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12053-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 12053-1-AP (same clone as 12053-1-PBS)

  IP result of anti-PELI1 (IP:12053-1-AP, 4ug; Detection:12053-1-AP 1:300) with SH-SY5Y cells lysate 3000ug. This data was developed using the same antibody clone with 12053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12053-1-AP (same clone as 12053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12053-1-AP (PELI1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12053-1-AP (same clone as 12053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12053-1-AP (PELI1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12053-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PELI1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12053-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12053-1-PBS targets PELI1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2683

  Product name: Recombinant human PELI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 294-418 aa of BC011419

  Sequence: MKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

• Full Name: pellino homolog 1 (Drosophila)
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46-53 kDa
• GenBank Accession Number: BC011419
• Gene Symbol: PELI1
• Gene ID (NCBI): 57162
• RRID: AB_2161180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PELI1 encodes pellino-1, an E3 ubiquitin-protein ligase pellino homolog. E3 ubiquitin ligase functions by catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Pellino-1 is involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Pellino-1 can mediate 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation thus playing a role in cellular inflammation. This antibody may cross react with Pellino-3.