PELI1 Recombinant monoclonal antibody

• 

  WB analysis using 87624-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87624-2-RR (PELI1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 87624-2-RR

  Non-treated RAW 264.7 cells and LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 87624-2-RR (PELI1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. The membrane was stripped and re-blotted with Alpha Tubulin antibody (66031-1-Ig) as loading control.

• 

  Affinity of 87624-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87624-2-RR against Human PELI1 were performed. The affinity constant is below 1 pM.

PELI1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87624-2-RR

Clone No.252984C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

E3 ubiquitin-protein ligase pellino homolog 1, EC:2.3.2.27, Pellino 1, Pellino-1, Pellino-related intracellular-signaling molecule

---

Tested Applications

• Positive WB detected in: Ramos cells, LPS treated RAW 264.7 cells, PC-12 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87624-2-RR targets PELI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2683

  Product name: Recombinant human PELI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 294-418 aa of BC011419

  Sequence: MKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

• Full Name: pellino homolog 1 (Drosophila)
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46-53 kDa
• GenBank Accession Number: BC011419
• Gene Symbol: PELI1
• Gene ID (NCBI): 57162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96FA3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PELI1 encodes pellino-1, an E3 ubiquitin-protein ligase pellino homolog. E3 ubiquitin ligase functions by catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Pellino-1 is involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Pellino-1 can mediate 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation thus playing a role in cellular inflammation.