PELO Recombinant monoclonal antibody, PBS Only (Capture)

PELO Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85743-1-PBS
Clone No.243137F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

CGI 17, CGI-17, hPelota, PRO1770, Protein Dom34 homolog

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85743-1-PBS targets PELO as part of a matched antibody pair:

MP02111-1: 85743-1-PBS capture and 85743-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0873

Product name: Recombinant human PELO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 42-384 aa of BC005889

Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE

Predict reactive species
Full Name pelota homolog (Drosophila)
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43-45 kDa
GenBank Accession NumberBC005889
Gene Symbol PELO
Gene ID (NCBI) 53918
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BRX2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].

Loading...
||
New chat

Able

正在加载,请稍候...