Product Information
67513-1-PBS targets PER2 (isoform 1) in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29489 Product name: Recombinant human PER2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 740-839 aa of NM_022817 Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS Predict reactive species |
Full Name | period homolog 2 (Drosophila) |
Calculated Molecular Weight | 137 kDa |
Observed Molecular Weight | 150~160 kDa |
GenBank Accession Number | NM_022817 |
Gene Symbol | PER2 |
Gene ID (NCBI) | 8864 |
RRID | AB_2882734 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15055 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).