PER2 (isoform 1) Monoclonal antibody, PBS Only

• 

  WB analysis using 67513-1-Ig (same clone as 67513-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67513-1-Ig (PER2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67513-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67513-1-Ig (same clone as 67513-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67513-1-Ig (PER2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67513-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67513-1-Ig (same clone as 67513-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PER2 (isoform 1) antibody (67513-1-Ig, Clone: 2E6C3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67513-1-PBS in a different storage buffer formulation.

PER2 (isoform 1) Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67513-1-PBS

Clone No.2E6C3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PER2, PER 2, hPER2, FASPS, 2E6C3

---

Product Information

67513-1-PBS targets PER2 (isoform 1) in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29489

  Product name: Recombinant human PER2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 740-839 aa of NM_022817

  Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS

• Full Name: period homolog 2 (Drosophila)
• Calculated Molecular Weight: 137 kDa
• Observed Molecular Weight: 150~160 kDa
• GenBank Accession Number: NM_022817
• Gene Symbol: PER2
• Gene ID (NCBI): 8864
• RRID: AB_2882734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15055
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).