PERM1 Recombinant monoclonal antibody

• 

  IHC staining of mouse skeletal muscle using 84425-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84425-5-RR (PERM1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 84425-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84425-5-RR (PERM1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of H9C2 using 84425-5-RR

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using PERM1 antibody (84425-5-RR, Clone: 241613B6 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84425-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84425-5-RR against Human PERM1 were performed. The affinity constant is below 1 pM.

PERM1 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 84425-5-RR

Clone No.241613B6

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

C1orf170, PERM, 241613B6

---

Tested Applications

• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: H9C2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84425-5-RR targets PERM1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23833

  Product name: Recombinant human C1orf170 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-58 aa of BC006300

  Sequence: MCLVFVAFATWAVRTSDPHTPDAWKTALLANVGTISAIRYFRRQAGQGRRSHSPSPSS

• Full Name: chromosome 1 open reading frame 170
• GenBank Accession Number: BC006300
• Gene Symbol: C1orf170
• Gene ID (NCBI): 84808
• RRID: AB_3671952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5SV97
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PERM1 (PGC-1/ERR-induced regulator in muscle 1) is a muscle-specific protein induced by PGC-1α and ERRα. PERM1 protein expression is mainly restricted to heart and skeletal muscle, indicating PERM1 functions as a tissue-specific regulator of mitochondrial biogenesis in response to exercise (PMID: 33549681, 36028747). Ablation of Perm1 in mice results in reduced protein expression of lipin-1 accompanied by accumulation of specific phospholipid species (PMID: 33549681). There are two major isoforms of Perm1 protein, the short isoform is about 85 kDa, and the long isoform is 105 kDa.