PET112L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PET112L Polyclonal antibody (26441-1-AP)

• 

  WB analysis using 26441-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26441-1-AP (PET112L antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

PET112L Polyclonal Antibody for WB, ELISA

Cat No. 26441-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Glu ADT subunit B, HSPC199, PET112, PET112 like (yeast), PET112L

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26441-1-AP targets PET112L in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23740

  Product name: Recombinant human PET112L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 204-557 aa of BC136547

  Sequence: SQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL

• Full Name: PET112-like (yeast)
• Observed Molecular Weight: 55-62 kDa
• GenBank Accession Number: BC136547
• Gene Symbol: PET112L
• Gene ID (NCBI): 5188
• RRID: AB_3669534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75879
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATB (Glutamyl-tRNA(Gln) amidotransferase subunit B), also called PET112L, is a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in the proper aminoacylation of mitochondrial glutaminyl mt-tRNA (mt-tRNA(Gln)). The other 2 subunits in the enzyme complex are GATA and GATC. The complex plays an essential role in mitochondrial translation and protein synthesis (PMID: 30283131, 19805282).