PEX19 Polyclonal antibody

• 

  WB analysis using 14713-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14713-1-AP (PEX19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14713-1-AP

  IP result of anti-PEX19 (IP:14713-1-AP, 3ug; Detection:14713-1-AP 1:300) with K-562 cells lysate 2400ug.

• 

  IHC staining of human liver cancer using 14713-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14713-1-AP (PEX19 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14713-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14713-1-AP (PEX19 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PEX19 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 14713-1-AP

Publications(12)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

33 kDa housekeeping protein, D1S2223E, HK33, Peroxin 19, PEX19, PMP1, PMPI, PXF, PXMP1

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, mouse heart tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IF: See 2 publications below

Product Information

14713-1-AP targets PEX19 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, arabidopsis
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6434

  Product name: Recombinant human PEX19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-299 aa of BC000496

  Sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM

• Full Name: peroxisomal biogenesis factor 19
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC000496
• Gene Symbol: PEX19
• Gene ID (NCBI): 5824
• RRID: AB_2162265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40855
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. PEX19 gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) (PMID: 14709540). PEX19 may bind newly synthesized PMPs and facilitate their insertion into the peroxisome membrane (PMID: 107044440. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14) (PMID:20683989) (PMID:10051604).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; 7-Dehydrocholesterol dictates ferroptosis sensitivity; Authors - Yaxu Li
mouse	WB	Nat Commun; Limited survival and impaired hepatic fasting metabolism in mice with constitutive Rag GTPase signaling.; Authors - Celia de la Calle Arregui
human	WB	Cell Death Differ; Peroxisome-driven ether-linked phospholipids biosynthesis is essential for ferroptosis.; Authors - Weiwei Cui
human	WB	J Cell Biol; Ubiquitin ligase MARCH5 localizes to peroxisomes to regulate pexophagy.; Authors - Jun Zheng
mouse	WB	Cell Commun Signal; TFEB activation triggers pexophagy for functional adaptation during oxidative stress under calcium deficient-conditions; Authors - Laxman Manandhar
human	IF	Cell Mol Life Sci; Dietary cysteine and methionine promote peroxisome elevation and fat loss by induction of CG33474 expression in Drosophila adipose tissue; Authors - Meng Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Susanne (Verified Customer) (07-03-2023)

very good in western blot, membrane blockes with milkpowder in TBST no non-specitif bands detection of ~60ng purified recomb. human Pex19 mit HRP-conjugated secondary antibody and ECL

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: recomb. human Pex19 with 6xHis-Tag

PEX19 Antibody Western Blot validation (1:4000 dilution) in recomb. human Pex19 with 6xHis-Tag (Cat no:14713-1-AP)

FH

Tom (Verified Customer) (09-08-2021)

Very good antibody - no non-specific bands. Membrane blocked with BSA in TBS.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HEK293

PEX19 Antibody Western Blot validation (1/1000 dilution) in HEK293 (Cat no:14713-1-AP)