PEX7 Polyclonal antibody, PBS Only

• 

  WB analysis using 20614-1-AP (same clone as 20614-1-PBS)

  HEK-293T cells lysate was subjected to SDS PAGE followed by western blot with 20614-1-AP (PEX7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20614-1-PBS in a different storage buffer formulation.

PEX7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20614-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Peroxin 7, Peroxin-7, PEX, PTS2 receptor, PTS2R

---

Product Information

20614-1-PBS targets PEX7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14666

  Product name: Recombinant human PEX7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 124-323 aa of BC006268

  Sequence: GEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA

• Full Name: peroxisomal biogenesis factor 7
• Calculated Molecular Weight: 323 aa, 36 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC006268
• Gene Symbol: PEX7
• Gene ID (NCBI): 5191
• RRID: AB_10694826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00628
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PEX7, also known as peroxisomal targeting signal 2 (PTS2) receptor, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively. PEX7 plays an essential role in peroxisomal protein import by binding to the N-terminal PTS2-type peroxisomal targeting signal. PEX7 defects are associated with peroxisome biogenesis disorder complementation group 11 (PBD-CG11), rhizomelic chondrodysplasia punctata type 1 (RCDP1) and Refsum disease.