Tested Applications
| Positive WB detected in | Human peripheral blood platelets tissue, mouse spleen tissue |
| Positive IP detected in | mouse serum |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
Product Information
21157-1-AP targets CXCL4/PF4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12345 Product name: Recombinant human PF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC093965 Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species |
| Full Name | platelet factor 4 |
| Calculated Molecular Weight | 101 aa, 11 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC093965 |
| Gene Symbol | PF4 |
| Gene ID (NCBI) | 5196 |
| RRID | AB_2878819 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02776 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| IHC protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| IP protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| WB protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol CXCL4:NLRP3-mediated pyroptosis product that regulates cardiac fibrosis | ||
Toxicol Appl Pharmacol Synergistic anticancer effects of ginsenoside CK and gefitinib against gefitinib-resistant NSCLC by regulating the balance of angiogenic factors through HIF-1α/VEGF | ||
Immun Inflamm Dis CXCL4/CXCR3 axis regulates cardiac fibrosis by activating TGF-β1/Smad2/3 signaling in mouse viral myocarditis | ||
J Biol Chem ELF4 facilitates innate host defenses against Plasmodium by activating transcription of Pf4 and Ppbp | ||
Int J Mol Med Platelet activation stimulates macrophages to enhance ulcerative colitis through PF4/CXCR3 signaling |









