PFKFB2 Polyclonal antibody

• 

  WB analysis using 17838-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17838-1-AP (PFKFB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse retina using 17838-1-AP

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 17838-1-AP (PFKFB2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

PFKFB2 Polyclonal Antibody for WB, ELISA

Cat No. 17838-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

Fructose-2,6-bisphosphatase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, 6-phosphofructo-2-kinase, 6PF-2-K/Fru-2,6-P2ase heart-type isozyme, 6PF-2-K/Fru-2,6-P2ase 2

---

Tested Applications

• Positive WB detected in: LNCaP cells, mouse retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below

Product Information

17838-1-AP targets PFKFB2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12181

  Product name: Recombinant human PFKFB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC075076

  Sequence: MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFAL

• Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
• Calculated Molecular Weight: 505 aa, 58 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC075076
• Gene Symbol: PFKFB2
• Gene ID (NCBI): 5208
• RRID: AB_2268128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60825
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFKFB2(6-Phosphofructo-2-kinase/fructose 2,6-bisphosphatase 2) is also named as PFK-2/FBPase-2, which is a bifunctional enzyme responsible for the synthesis and breakdown of Fru-2,6-P2 in the regulation of glycolysis(PMID:10095107). In the C-terminal section, it belongs to the phosphoglycerate mutase family. The enzyme is a dimer of identical subunits, each composed of 505 amino acids and containing three discrete domains(PMID: 2552438). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Elife; Hepatic AMPK signaling dynamic activation in response to REDOX balance are sentinel biomarkers of exercise and antioxidant intervention to improve blood glucose control; Authors - Meiling Wu
human	WB	Cell Death Dis; SLIT2/ROBO1 axis contributes to the Warburg effect in osteosarcoma through activation of SRC/ERK/c-MYC/PFKFB2 pathway.; Authors - Shu-Jie Zhao
human	WB	Free Radic Biol Med; Glutaredoxins concomitant with optimal ROS activate AMPK through S-glutathionylation to improve glucose metabolism in type 2 diabetes.; Authors - Kelei Dong
mouse	WB	J Biol Chem; Type 2 Diabetes Dysregulates Glucose Metabolism in Cardiac Progenitor Cells.; Authors - Joshua K Salabei
human	WB	Int J Biochem Cell Biol; A transcriptional target of androgen receptor, miR-421 regulates proliferation and metabolism of prostate cancer cells.; Authors - Delong Meng
human	WB	J Transl Med; Small molecule inhibition of 6-phosphofructo-2-kinase suppresses t cell activation.; Authors - Telang Sucheta S