PFKM Polyclonal antibody

• 

  WB analysis using 30326-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30326-1-AP (PFKM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 30326-1-AP

  WB result of PFKM antibody (30326-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PFKM transfected HEK-293 cells.

• 

  WB analysis using 30326-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30326-1-AP (PFKM antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 30326-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 30326-1-AP (PFKM antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 30326-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 30326-1-AP (PFKM antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 30326-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed 48-well HepG2 cells using PFKM antibody (30326-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PFKM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30326-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PFK-A, PFK A, EC:2.7.1.11, ATP-PFK, ATP-dependent 6-phosphofructokinase, muscle type

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells, Raji cells, MCF-7 cells
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: 48-well HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30326-1-AP targets PFKM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30840

  Product name: Recombinant human PFKM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 675-725 aa of BC021203

  Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE

• Full Name: phosphofructokinase, muscle
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC021203
• Gene Symbol: PFKM
• Gene ID (NCBI): 5213
• RRID: AB_3086294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular masses of 85, 82 and 93 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; Gboxin Induced Apoptosis and Ferroptosis of Cervical Cancer Cells by Promoting Autophagy-Mediated Inhibition of Nrf2 Signaling Under Low-Glucose Conditions; Authors - Wei Liu