Product Information
84281-2-PBS targets PFKM as part of a matched antibody pair:
MP01204-1: 84281-2-PBS capture and 84281-3-PBS detection (validated in Cytometric bead array)
MP01204-2: 84281-1-PBS capture and 84281-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30840 Product name: Recombinant human PFKM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 675-725 aa of BC021203 Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE Predict reactive species |
| Full Name | phosphofructokinase, muscle |
| GenBank Accession Number | BC021203 |
| Gene Symbol | PFKM |
| Gene ID (NCBI) | 5213 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08237 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
