Profilin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Profilin 1 Polyclonal antibody (11680-1-AP)

• Featured Product
• KD/KO Validated

Profilin 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11680-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

PFN1, ALS18, PFN 1, Profilin I, profilin1

• 

  WB analysis using 11680-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11680-1-AP (Profilin 1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HAP1 using 11680-1-AP

  HAP1 (WT and PFN1 KO) lysates prepared with NP-40 buffer, 50 μg protein loaded. 11680-1-AP  incubated at 1:6000 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IHC staining of human colon using 11680-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 11680-1-AP (Profilin 1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Profilin 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HAP1 cells, C6 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11680-1-AP targets Profilin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2286

  Product name: Recombinant human PFN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC006768

  Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

• Full Name: profilin 1
• Calculated Molecular Weight: 140 aa, 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC006768
• Gene Symbol: Profilin 1
• Gene ID (NCBI): 5216
• RRID: AB_2163182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07737
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.

Publications

What published studies show

The PFN1 antibody (cat# 11680-1-AP) has 15 citations across journals including Biomaterials, J Exp Clin Cancer Res, Oncotarget, Life Sci, Am J Pathol, J Adv Res, Cancer Gene Ther, Sci Rep, Oncol Rep, JBMR Plus, Front Genet, PLoS One, Tumour Biol, F1000Res, and Genomics. Research fields span cancer biology (nasopharyngeal, colorectal, cervical, lung, and myeloma), cardiovascular/endothelial biology, stroke, bone remodeling, airway inflammation, trophoblast function, and metabolic effects of sleep deprivation.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Adv Res; SLC3A2-mediated BCAAs transport promotes airway inflammation and remodeling in chronic obstructive pulmonary disease via acetylation of PFN1.; Authors - Ruonan Yang
human	WB	J Exp Clin Cancer Res; Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway.; Authors - Yu Lian
human	WB	Biomaterials; The molecular mechanism for effects of TiN coating on NiTi alloy on endothelial cell function.; Authors - Dayun Yang
mouse	WB,IF	Life Sci; LncRNA PEG11as aggravates cerebral ischemia/reperfusion injury after ischemic stroke through miR-342-5p/PFN1 axis; Authors - Zhijun Yu
human	WB	Cancer Gene Ther; METTL3-mediated RanGAP1 promotes colorectal cancer progression through the MAPK pathway by recruiting YTHDF1; Authors - Rui Yang
human	WB	Oncotarget; Upregulated long non-coding RNA AFAP1-AS1 expression is associated with progression and poor prognosis of nasopharyngeal carcinoma.; Authors - Hao Bo