Use Able AI chat for product recommendations

PFTK1 Polyclonal antibody

PFTK1 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

CDK14, hPFTAIRE1, KIAA0834, PFTAIRE protein kinase 1, PFTAIRE1, PFTK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PFTK1 in ?

Tested Applications

Positive WB detected inHeLa cells, mouse brain tissue, SH-SY5Y cells
Positive IHC detected inhuman kidney tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21612-1-AP targets PFTK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16259

Product name: Recombinant human PFTK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 303-451 aa of BC136477

Sequence: IFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH

Predict reactive species
Full Name PFTAIRE protein kinase 1
Calculated Molecular Weight 469 aa, 53 kDa
Observed Molecular Weight 48-53 kDa
GenBank Accession NumberBC136477
Gene Symbol PFTK1
Gene ID (NCBI) 5218
RRIDAB_10858924
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94921
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFTK1 is a Cdc2-related protein kinase, also named as PFTAIRE1, CDK14 and belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. It acts as a cyclin-dependent kinases that regulates cell cycle progression and cell proliferation. The PFTK1 protein shows high homology with mouse Pftaire1, a Cdc2-related protein expressed primarily in the postnatal and adult nervous system(PMID:9202329). The protein contains 2 predicted nuclear localization signals that the N-terminal nuclear localization signals do not play a role in vivo(PMID:11313143). It has 3 isoforms produced by alternative splicing. This antibody is specific to PFTK1.

Protocols

Product Specific Protocols
IHC protocol for PFTK1 antibody 21612-1-APDownload protocol
WB protocol for PFTK1 antibody 21612-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PFTK1 Polyclonal antibody (Cat# 21612-1-AP) has 6 citations published in Molecular Biomedicine, Communications Biology, Molecular Therapy Oncolytics, Biomedicine & Pharmacotherapy, Toxicology Letters, and World Neurosurgery. Research fields span non-small cell lung cancer metastasis and drug resistance, pancreatic cancer oncolytic therapy, ovarian cancer miRNA regulation, cigarette smoke toxicity, and vestibular schwannoma proliferation.

SpeciesApplicationTitle

Mol Biomed

5-Hydroxytryptamine promotes non-small cell lung cancer metastasis via the SNRPG/WT1/CDK14 Axis

Authors - Jinzhe Sun
humanWB

Commun Biol

Methylation-modulated PFTK1 regulates gefitinib resistance via Wnt/β-catenin signaling in EGFR mutant non-small-cell lung cancer cells

Authors - Xiaoting Jia
humanWB

Mol Ther Oncolytics

Acquired chemoresistance can lead to increased resistance of pancreatic cancer cells to oncolytic vesicular stomatitis virus

Authors - Dakota W. Goad
humanWB,IHC

Biomed Pharmacother

MiR-542-3p, a microRNA targeting CDK14, suppresses cell proliferation, invasiveness, and tumorigenesis of epithelial ovarian cancer.

Authors - Jingwei Li
mouseWB, IHC, IF

Toxicol Lett

CDK14 expression is down-regulated by cigarette smoke in vivo and in vitro.

Authors - Daniel Pollack
humanWB

World Neurosurg

MiR-205 Inhibits Sporadic Vestibular Schwannoma Cell Proliferation by Targeting Cyclin-Dependent Kinase 14.

Authors - Xiaoling Yin
Loading...
||
New chat

Able™

正在加载,请稍候...