Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, SH-SY5Y cells | 
| Positive IHC detected in | human kidney tissue,  mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below | 
| IHC | See 2 publications below | 
| IF | See 1 publications below | 
Product Information
21612-1-AP targets PFTK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag16259 Product name: Recombinant human PFTK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 303-451 aa of BC136477 Sequence: IFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH Predict reactive species | 
                                    
| Full Name | PFTAIRE protein kinase 1 | 
| Calculated Molecular Weight | 469 aa, 53 kDa | 
| Observed Molecular Weight | 48-53 kDa | 
| GenBank Accession Number | BC136477 | 
| Gene Symbol | PFTK1 | 
| Gene ID (NCBI) | 5218 | 
| RRID | AB_10858924 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O94921 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
PFTK1 is a Cdc2-related protein kinase, also named as PFTAIRE1, CDK14 and belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. It acts as a cyclin-dependent kinases that regulates cell cycle progression and cell proliferation. The PFTK1 protein shows high homology with mouse Pftaire1, a Cdc2-related protein expressed primarily in the postnatal and adult nervous system(PMID:9202329). The protein contains 2 predicted nuclear localization signals that the N-terminal nuclear localization signals do not play a role in vivo(PMID:11313143). It has 3 isoforms produced by alternative splicing. This antibody is specific to PFTK1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PFTK1 antibody 21612-1-AP | Download protocol | 
| WB protocol for PFTK1 antibody 21612-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Commun Biol Methylation-modulated PFTK1 regulates gefitinib resistance via Wnt/β-catenin signaling in EGFR mutant non-small-cell lung cancer cells | ||
Mol Ther Oncolytics Acquired chemoresistance can lead to increased resistance of pancreatic cancer cells to oncolytic vesicular stomatitis virus | ||
World Neurosurg MiR-205 Inhibits Sporadic Vestibular Schwannoma Cell Proliferation by Targeting Cyclin-Dependent Kinase 14. | ||
Biomed Pharmacother MiR-542-3p, a microRNA targeting CDK14, suppresses cell proliferation, invasiveness, and tumorigenesis of epithelial ovarian cancer. | 

















