Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, NIH/3T3 cells, Raji cells, HeLa cells, HEK-293T cells, Jurkat cells, CHO cells |
| Positive IHC detected in | human normal colon, human brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 34 publications below |
| IHC | See 4 publications below |
| IF | See 5 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
16126-1-AP targets PGAM1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9110 Product name: Recombinant human PGAM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC011678 Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK Predict reactive species |
| Full Name | phosphoglycerate mutase 1 (brain) |
| Calculated Molecular Weight | 254 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC011678 |
| Gene Symbol | PGAM1 |
| Gene ID (NCBI) | 5223 |
| RRID | AB_2160786 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18669 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PGAM1 antibody 16126-1-AP | Download protocol |
| IHC protocol for PGAM1 antibody 16126-1-AP | Download protocol |
| WB protocol for PGAM1 antibody 16126-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell The long noncoding RNA glycoLINC assembles a lower glycolytic metabolon to promote glycolysis. | ||
Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. | ||
EMBO J Fatty acid synthesis is critical for stem cell pluripotency via promoting mitochondrial fission. | ||
Pharmacol Res RHBDF1 deficiency suppresses melanoma glycolysis and enhances efficacy of immunotherapy by facilitating glucose-6-phosphate isomerase degradation via TRIM32 | ||
Int J Biol Macromol Ubiquitin-conjugating enzyme E2S decreases the sensitivity of glioblastoma cells to temozolomide by upregulating PGAM1 via the interaction with OTUB2 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marco (Verified Customer) (07-04-2024) | It is a very well functioning antibody
|















