Product Information
68644-1-PBS targets PGF/PIGF as part of a matched antibody pair:
MP50063-1: 68644-2-PBS capture and 68644-1-PBS detection (validated in Sandwich ELISA)
MP50063-2: 68644-3-PBS capture and 68644-1-PBS detection (validated in Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Affinity | KD=2.49 x 10-9M KOff=1.28 x 10-4M KOn=5.12 x 104M |
Immunogen |
CatNo: Eg0653 Product name: Recombinant Human PGF/PIGF protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-149 aa of NP_001193941.1 Sequence: AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR Predict reactive species |
Full Name | placental growth factor |
Calculated Molecular Weight | 17KD |
GenBank Accession Number | NP_001193941.1 |
Gene Symbol | PGF |
Gene ID (NCBI) | 5228 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P49763-2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |