Filter: AllWBIHCIF-PFC (Intra)

WB analysis using 68228-1-Ig (same clone as 68228-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68228-1-Ig (PGK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
WB analysis using 68228-1-Ig (same clone as 68228-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68228-1-Ig (PGK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
WB analysis of HuH-7 using 68228-1-Ig (same clone as 68228-1-PBS)
HuH-7 cells were subjected to SDS PAGE followed by western blot with 68228-1-Ig (PGK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 68228-1-Ig (same clone as 68228-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 68228-1-Ig (PGK2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 68228-1-Ig (same clone as 68228-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68228-1-Ig (PGK2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 68228-1-Ig (same clone as 68228-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68228-1-Ig (PGK2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 68228-1-Ig (same clone as 68228-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 68228-1-Ig (PGK2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 68228-1-Ig (same clone as 68228-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PGK2 antibody (68228-1-Ig, Clone: 3D4F2 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
FC experiment of A549 using 68228-1-Ig (same clone as 68228-1-PBS)
1X10^6 A549 cells were intracellularly stained with 0.4 ug Anti-Human PGK2 (68228-1-Ig, Clone:3D4F2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.
×
1X10^6 A549 cells were intracellularly stained with 0.4 ug Anti-Human PGK2 (68228-1-Ig, Clone:3D4F2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68228-1-PBS in a different storage buffer formulation.

PGK2 Monoclonal antibody, PBS Only

PGK2 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 68228-1-PBS

Clone No.3D4F2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

3D4F2, EC:2.7.2.3, PGKB, PGKPS

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68228-1-PBS targets PGK2 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag20631 Product name: Recombinant human PGK2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species
Full Name	phosphoglycerate kinase 2
Calculated Molecular Weight	417 aa, 45 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	BC038843
Gene Symbol	PGK2
Gene ID (NCBI)	5232
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P07205
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP.