PGM2L1 Polyclonal antibody

• 

  WB analysis using 13942-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13942-1-AP (PGM2L1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 13942-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13942-1-AP (PGM2L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13942-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13942-1-AP (PGM2L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 13942-1-AP

  IP result of anti-PGM2L1 (IP:13942-1-AP, 4ug; Detection:13942-1-AP 1:300) with mouse brain tissue lysate 4000 ug.

• 

  IHC staining of human gliomas using 13942-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13942-1-AP (PGM2L1 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 13942-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13942-1-AP (PGM2L1 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGM2L1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13942-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

BM32A, EC:2.7.1.106, Glucose 1,6-bisphosphate synthase, Phosphoglucomutase-2-like 1, PMMLP

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

13942-1-AP targets PGM2L1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5019

  Product name: Recombinant human PGM2L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 269-622 aa of BC059360

  Sequence: GHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV

• Full Name: phosphoglucomutase 2-like 1
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC059360
• Gene Symbol: PGM2L1
• Gene ID (NCBI): 283209
• RRID: AB_2299394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PCE3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PGM2L1 (Phosphoglucomutase 2 Like 1) is an enzyme-like protein involved in carbohydrate metabolism. PGM2L1 catalyzes the formation of G16BP by using the glycolytic intermediate 1,3-bisphosphoglycerate as a phosphate donor and glucose-1-phosphate or glucose-6-phosphate as a phosphate acceptor. PGM2L1 plays a crucial role in glycogen metabolism, glycolysis, and gluconeogenesis as a key enzyme, and increasing evidence links its function to cancer metabolism and progression. While PGM2 has a wide tissue distribution, PGM2L1 is highly expressed in the brain, accounting for the elevated concentrations of glucose-1,6-bisphosphate found there (PMID: 33979636, PMID: 40027181).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Mol Metab; Glucose-1,6-bisphosphate: a new gatekeeper of cerebral mitochondrial pyruvate uptake; Authors - Motahareh Solina Safari ; KD Validated
mouse	WB	Metabolism; Protein kinase N1 deficiency results in upregulation of cerebral energy metabolism and is highly protective in in vivo and in vitro stroke models; Authors - Stephanie Zur Nedden
human	WB,IHC	Cell Death Dis; Cancer-associated fibroblasts secrete CSF3 to promote TNBC progression via enhancing PGM2L1-dependent glycolysis reprogramming; Authors - Wenqi Qin