Product Information
82965-1-PBS targets PGM5 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34399 Product name: Recombinant human PGM5 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-80 aa of NM_021965 Sequence: MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAIEIVV Predict reactive species |
| Full Name | phosphoglucomutase 5 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | NM_021965 |
| Gene Symbol | PGM5 |
| Gene ID (NCBI) | 5239 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15124 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Phosphoglucomutase-like protein 5 (also known as aciculin) is an enzyme encoded by the PGM5 gene. Gene functional studies show that PGM5 is similar to PGM1 but lacks enzymatic activity. PGM5 is tightly associated with the actin cytoskeleton and has primarily been investigated as an adhesion protein. It also functions as a cytoskeletal component of cell-matrix and cell-cell contacts in muscle and non-muscle cells. (PMID: 35819729)









