PGM5 Recombinant monoclonal antibody

PGM5 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 82965-1-RR
Clone No.230206C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

230206C7, Aciculin, PGMRP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, PC-3 cells
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82965-1-RR targets PGM5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34399

Product name: Recombinant human PGM5 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-80 aa of NM_021965

Sequence: MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAIEIVV

Predict reactive species
Full Name phosphoglucomutase 5
Calculated Molecular Weight 62 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberNM_021965
Gene Symbol PGM5
Gene ID (NCBI) 5239
RRIDAB_3670711
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15124
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phosphoglucomutase-like protein 5 (also known as aciculin) is an enzyme encoded by the PGM5 gene. Gene functional studies show that PGM5 is similar to PGM1 but lacks enzymatic activity. PGM5 is tightly associated with the actin cytoskeleton and has primarily been investigated as an adhesion protein. It also functions as a cytoskeletal component of cell-matrix and cell-cell contacts in muscle and non-muscle cells. (PMID: 35819729)

Protocols

Product Specific Protocols
IHC protocol for PGM5 antibody 82965-1-RRDownload protocol
WB protocol for PGM5 antibody 82965-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...