PHAX Polyclonal antibody, PBS Only

PHAX Polyclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 16481-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16481-1-PBS targets PHAX in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9602

Product name: Recombinant human PHAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-394 aa of BC021161

Sequence: MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF

Predict reactive species
Full Name phosphorylated adaptor for RNA export
Calculated Molecular Weight 394 aa, 44 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC021161
Gene Symbol PHAX
Gene ID (NCBI) 51808
RRIDAB_2299663
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H814
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Small nuclear and small nucleolar RNAs (snRNAs and snoRNAs) are essential components of snRNPs and snoRNPs, and have a critical role in the maturation of, respectively, mRNAs and rRNAs within the nucleus of eukaryotic cells. Complex and specific pathways exist for the assembly of snRNPs and snoRNPs, involving, nucleocytoplasmic transport of snRNAs and intranuclear transport between compartments of snoRNAs. In metazoa, a subset of spliceosomal snRNAs are exported from the nucleus after transcription. This export occurs in a large complex containing a snRNA, the nuclear cap binding complex (CBC), RanGTP, the leucine-rich nuclear export signal receptor CRM1/Xpo1, and the recently identified phosphoprotein PHAX (phosphorylated adaptor for RNA export). PHAX contains a conserved single-stranded nucleic acid binding domain (RNA_GG_bind domain) with no sequence homology with any other known RNA-binding module [PMID:15574332,11333016, 15574332]

Loading...
||
New chat Able
正在加载,请稍候...